GAL4 antibody (C-Term)

Catalog No. ABIN4886660

Product Details anti-GAL4 Antibody

Target: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Binding Specificity: AA 283-320, C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAL4 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Galectin-4(LGALS4) detection. Tested with WB in Human.

Sequence: DRFKVYANGQ HLFDFAHRLS AFQRVDTLEI QGDVTLSY

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Galectin-4(LGALS4) detection. Tested with WB in Human.
Gene Name: lectin, galactoside binding soluble 4
Protein Name: Galectin-4

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY), different from the related mouse and rat sequences by seven amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for GAL4

Target: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Alternative Name: LGALS4 (LGALS4 Products)

Synonyms: LGALS4 antibody, gal4 antibody, l36lbp antibody, MGC86186 antibody, galectin-4 antibody, xgalectin-VIa antibody, gal-4 antibody, L36LBP antibody, L-36 antibody, L36LBI antibody, GAL4 antibody, galectin 4 antibody, lectin, galactoside-binding, soluble, 4 L homeolog antibody, Galectin-4 antibody, lectin, galactose binding, soluble 4 antibody, LGALS4 antibody, lgals4.L antibody, leg4 antibody, Lgals4 antibody

Background: Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.

Synonyms: Antigen NY CO 27 | Antigen NY-CO-27 | Antigen NYCO27 | GAL 4 | Gal-4 | GAL4 | Galectin 4 | Galectin-4 | Galectin -4 | L36LBP | LGALS4 | P56470

Gene ID: 3960

UniProt: P56470