GNA12 antibody (Guanine Nucleotide Binding Protein (G Protein) alpha 12) (Isoform alpha-12)

Details for Product anti-GNA12 Antibody No. ABIN4890651, Supplier: Log in to see
Antigen
  • NNX3
  • RMP
  • gep
  • gna12
  • gna12l
  • AI414047
  • AI504261
  • Galpha12
  • guanine nucleotide binding protein (G protein) alpha 12
  • guanine nucleotide binding protein (G protein) alpha 12a
  • guanine nucleotide binding protein, alpha 12
  • GNA12
  • Gna12
  • gna12a
Epitope
Isoform alpha-12
17
15
4
3
3
2
2
1
1
1
1
1
Reactivity
Human
49
26
24
6
5
5
5
5
4
4
3
3
1
1
1
Host
Rabbit
49
2
1
Clonality
Polyclonal
Conjugate
This GNA12 antibody is un-conjugated
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
39
21
13
4
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen Synthetic peptides corresponding to GNA12(guanine nucleotide binding protein (G protein) alpha 12) The peptide sequence was selected from the middle region of GNA12. Peptide sequence TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF.
Specificity This product is specific to Subunit or Isoform: alpha-12.
Purification Immunogen affinity purified
Alternative Name G Protein alpha 12 (GNA12 Antibody Abstract)
Background Gene Symbol: GNA12
Molecular Weight Theoretical MW: 44 kDa
Gene ID 2768
UniProt Q03113
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against GNA12 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-GNA12 antibody (Guanine Nucleotide Binding Protein (G Protein) alpha 12) (Isoform alpha-12) (ABIN4890651) Western Blot: G protein alpha 12 Antibody [NBP1-55321] - Titration: 0.2-1 ug/ml, Posi...