Glutamyl-tRNA Synthetase 2 Mitochondrial (Putative) (EARS2) antibody

Details for Product No. ABIN4890846, Supplier: Log in to see
Antigen
  • mse1
  • 3230401I01Rik
  • AL024049
  • mKIAA1970
  • COXPD12
  • MSE1
  • RGD1307904
  • ears2
  • glutamyl-tRNA synthetase 2, mitochondrial
  • glutamyl-tRNA synthetase 2, mitochondrial (putative)
  • glutamyl-tRNA synthetase 2 (mitochondrial)(putative)
  • zgc:153247
  • EARS2
  • ears2
  • Ears2
  • zgc:153247
Reactivity
Human
18
2
2
1
1
1
1
1
1
1
Host
Rabbit
16
2
Clonality
Polyclonal
Application
Western Blotting (WB)
13
7
6
5
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to EARS2(glutamyl-tRNA synthetase 2, mitochondrial (putative)) The peptide sequence was selected from the middle region of EARS2. Peptide sequence TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL.
Purification Immunogen affinity purified
Alternative Name EARS2 (EARS2 Antibody Abstract)
Background Gene Symbol: EARS2
Gene ID 124454
UniProt Q86YH3
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against EARS2 and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Glutamyl-tRNA Synthetase 2 Mitochondrial (Putative) (EARS2) antibody (ABIN4890846) Western Blot: EARS2 Antibody [NBP1-56400] - 721_B cell lysate, concentration 0.2-1 ug...
Did you look for something else?