Malignant T Cell Amplified Sequence 1 (MCTS1) (N-Term) antibody

Details for Product No. ABIN4891880, Supplier: Log in to see
Antigen
  • mcts1
  • MCT-1
  • MGC89874
  • MCTS1
  • MCT1
  • 1500019M23Rik
  • zgc:56242
  • MCT-1A
  • mct-1
  • mct1
  • HHF7
  • MCT
  • RATMCT1
  • RNMCT1
  • AL022710
  • Mct1
  • MCT1a
  • cb517
  • zgc:55682
  • modifier of curly tail 1
  • malignant T cell amplified sequence 1
  • monocarboxylate transporter 1
  • solute carrier family 16 (monocarboxylate transporter), member 1
  • solute carrier family 16 (monocarboxylic acid transporters), member 1
  • solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
  • mct1
  • TEgg094c21.2
  • MCTS1
  • mcts1
  • Mcts1
  • mcts1-a
  • MCT1
  • SLC16A1
  • Slc16a1
  • slc16a1
Epitope
N-Term
16
10
7
7
4
3
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human, Mouse (Murine)
79
34
24
6
6
5
5
4
3
3
2
2
1
1
1
Host
Rabbit
54
18
12
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
61
25
14
13
12
7
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptides corresponding to MCTS1(malignant T cell amplified sequence 1) The peptide sequence was selected from the N terminal of MCTS1. Peptide sequence MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV.
Purification Immunogen affinity purified
Alternative Name MCTS1 (MCTS1 Antibody Abstract)
Background Gene Symbol: MCTS1
Molecular Weight Theoretical MW: 20 kDa
Gene ID 28985
UniProt Q9ULC4
Research Area Transporters
Application Notes Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against MCTS1 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Malignant T Cell Amplified Sequence 1 (MCTS1) (N-Term) antibody (ABIN4891880) Western Blot: MCTS1 Antibody [NBP1-58236] - COLO205 cells lysate, concentration 0.2-1...
Product cited in: Haas, Ngo, Li, Schleich, Qu, Vanyai, Cullen, Cardona-Alberich, Gladwyn-Ng, Pagnamenta, Taylor, Stewart, Kini, Duncan, Teleman, Keays, Heng: "De Novo Mutations in DENR Disrupt Neuronal Development and Link Congenital Neurological Disorders to Faulty mRNA Translation Re-initiation." in: Cell reports, Vol. 15, Issue 10, pp. 2251-65, 2016 (PubMed). (Sample species: Mouse (Murine)). Further details: Western Blotting

Did you look for something else?