Zinc Finger Protein 280A (ZNF280A) (C-Term) antibody

Details for Product No. ABIN4893825, Supplier: Log in to see
  • SUHW1
  • ZNF280
  • ZNF636
  • 3'OY11.1
  • zinc finger protein 280A
  • ZNF280A
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptide directed towards the C terminal of human ZNF280A. Peptide sequence WRHSRRRVLQCSKCRLQFLTLKEEIEHKTKDHQTFKKPEQLQGFPRETKV.
Purification Immunogen affinity purified
Alternative Name SUHW1 (ZNF280A Antibody Abstract)
Background Gene Symbol: ZNF280A
Gene ID 129025
NCBI Accession NP_542778
Research Area Transcription Factors, Chromatin and Nuclear Signaling
Application Notes Western Blot 1:1000This is a rabbit polyclonal antibody against ZNF280A and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Zinc Finger Protein 280A (ZNF280A) (C-Term) antibody (ABIN4893825) Western Blot: SUHW1 Antibody [NBP1-79409] - Human Brain lysate, concentration 0.2-1 u...
Did you look for something else?