CYB5R2 antibody (Cytochrome B5 Reductase 2) (C-Term)

Details for Product anti-CYB5R2 Antibody No. ABIN4893938, Supplier: Log in to see
  • B5R.2
  • D630003K02Rik
  • b5R.2
  • RGD1308421
  • b5r
  • im:7147295
  • zgc:153291
  • cytochrome b5 reductase 2
  • cyb5r2
  • CYB5R2
  • Cyb5r2
Rat (Rattus)
Western Blotting (WB)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen Synthetic peptide directed towards the C terminal of human Cyb5r2The immunogen for this antibody is Cyb5r2. Peptide sequence WEYSSGFITADMIKEHLPPPGEATLILVCGPPPLIQEAAHPSLEQLGYTK.
Purification Immunogen affinity purified
Alternative Name CYB5R2 (CYB5R2 Antibody Abstract)
Background Gene Symbol: CYB5R2
Molecular Weight Theoretical MW: 30 kDa
Gene ID 51700
NCBI Accession NP_001014266
Research Area Metabolism
Application Notes Western Blot 1:1000This is a rabbit polyclonal antibody against Cyb5r2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-CYB5R2 antibody (Cytochrome B5 Reductase 2) (C-Term) (ABIN4893938) Western Blot: CYB5R2 Antibody [NBP1-79540] - Rat Lung lysate, concentration 0.2-1 ug/ml.