Zinc Finger Protein 566 (ZNF566) antibody

Details for Product No. ABIN4894367, Supplier: Log in to see
Antigen
  • ZNF420
  • RGD1563239
  • zinc finger protein 566
  • ZNF566
  • Zfp566
Reactivity
Human
32
7
6
4
3
3
3
2
2
1
1
Host
Rabbit
32
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
2
2
2
2
Application
Western Blotting (WB)
29
16
2
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptide directed towards the middle region of human ZNF566. Peptide Sequence: VFTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEII
Purification Immunogen affinity purified
Alternative Name ZNF566 (ZNF566 Antibody Abstract)
Background Gene Symbol: ZNF566
Molecular Weight Theoretical MW: 49 kDa
Gene ID 84924
NCBI Accession NP_116227
Research Area Transcription Factors, Chromatin and Nuclear Signaling
Application Notes Western Blot 1:1000This is a rabbit polyclonal antibody against ZNF566 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Preservative Without preservative
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Zinc Finger Protein 566 (ZNF566) antibody (ABIN4894367) Western Blot: ZNF566 Antibody [NBP1-80126] - Human kidney lysate, concentration 0.2-1...
Did you look for something else?