Transmembrane Protein 48 (TMEM48) antibody

Details for Product No. ABIN4894930, Supplier: Log in to see
Antigen
  • tmem48
  • wu:fk93f04
  • zgc:55636
  • NET3
  • TMEM48
  • 2810475A17Rik
  • AI450313
  • Tmem48
  • NDC1 transmembrane nucleoporin
  • transmembrane protein 48
  • ndc1
  • NDC1
  • Ndc1
  • TMEM48
Reactivity
Human
11
6
6
4
4
4
4
3
3
2
2
2
2
1
1
Host
Rabbit
11
Clonality
Polyclonal
Application
Western Blotting (WB)
9
1
1
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen Synthetic peptide directed towards the middle region of human TMEM48. Peptide sequence SFTEDRFGVVQTTLPAILNTLLTLQEAVDKYFKLPHASSKPPRISGSLVD.
Purification Immunogen affinity purified
Alternative Name TMEM48 (TMEM48 Antibody Abstract)
Background Gene Symbol: TMEM48
Gene ID 55706
NCBI Accession NP_060557
Application Notes Western Blot 1:1000This is a rabbit polyclonal antibody against TMEM48 and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Transmembrane Protein 48 (TMEM48) antibody (ABIN4894930) Western Blot: TMEM48 Antibody [NBP1-91603] - THP-1 cell lysate, concentration 0.2-1 u...
Did you look for something else?