Presequence Translocase-Associated Motor 16 Homolog (S. Cerevisiae) (PAM16) (C-Term) antibody

Details for Product No. ABIN4895155, Supplier: Log in to see
Antigen
  • Magmas
  • RGD1564452
  • Tim16
  • Timm16
  • MAGMAS
  • TIM16
  • TIMM16
  • 2010110I09Rik
  • AV006767
  • CGI-136
  • mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction, pseudogene 1
  • presequence translocase-associated motor 16 homolog (S. cerevisiae)
  • presequence translocase-asssociated motor 16 homolog (S. cerevisiae)
  • Magmas-ps1
  • PAM16
  • Pam16
Epitope
C-Term
3
1
1
Reactivity
Human
21
3
1
1
1
Host
Rabbit
19
2
Clonality
Polyclonal
Conjugate
Un-conjugated
3
3
3
Application
Western Blotting (WB)
10
3
3
2
1
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen The immunogen for this antibody is Magmas - C-terminal region. Peptide sequence NYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT.
Purification Immunogen affinity purified
Alternative Name Magmas (PAM16 Antibody Abstract)
Background Gene Symbol: PAM16
Molecular Weight Theoretical MW: 14 kDa
Gene ID 51025
NCBI Accession NP_057153
Application Notes Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Presequence Translocase-Associated Motor 16 Homolog (S. Cerevisiae) (PAM16) (C-Term) antibody (ABIN4895155) Western Blot: Magmas Antibody [NBP1-98528] - Hela, Antibody Dilution: 1.0 ug/ml PAM16...
Western Blotting (WB) image for anti-Presequence Translocase-Associated Motor 16 Homolog (S. Cerevisiae) (PAM16) (C-Term) antibody (ABIN4895155) Western Blot: Magmas Antibody [NBP1-98528] - Titration: 1.0 ug/ml Positive Control: H...
Western Blotting (WB) image for anti-Presequence Translocase-Associated Motor 16 Homolog (S. Cerevisiae) (PAM16) (C-Term) antibody (ABIN4895155) Western Blot: Magmas Antibody [NBP1-98528] - Jurkat, Antibody Dilution: 1.0 ug/ml PAM...
Did you look for something else?