Golgi SNAP Receptor Complex Member 1 (GOSR1) (C-Term) antibody

Details for Product No. ABIN4960978, Supplier: Log in to see
Antigen
  • CG7700
  • Dmel\\CG7700
  • FSG28
  • GOS28
  • dgos28
  • GOSR1
  • gosr1
  • zgc:112064
  • GOLIM2
  • GOS-28
  • GOS28/P28
  • GS28
  • P28
  • AI414660
  • AI426320
  • BB145494
  • GOSRI
  • p28
  • Gos28
  • v-SNARE
  • CG7700 gene product from transcript CG7700-RA
  • golgi SNAP receptor complex member 1
  • Golgi SNAP receptor complex member 1
  • Protein GOS-28
  • Gos28
  • GOSR1
  • gosr1
  • CpipJ_CPIJ014329
  • PAAG_02888
  • Tsp_07481
  • Gosr1
  • gos-28
Epitope
C-Term
7
5
3
3
2
2
2
2
1
1
Reactivity
Human
47
34
31
6
6
6
5
4
4
3
2
2
2
1
1
1
Host
Rabbit
37
17
Clonality
Polyclonal
Conjugate
Un-conjugated
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
38
13
11
9
8
5
3
2
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Immunogen Synthetic peptides corresponding to GOSR1 (golgi SNAP receptor complex member 1) The peptide sequence was selected form the C terminal of GOSR1. Peptide sequence IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH.
Purification Immunogen affinity purified
Alternative Name GOSR1 (GOSR1 Antibody Abstract)
Background Gene Symbol: GOSR1
Gene ID 9527
UniProt O95249
Research Area Signaling, Transporters
Application Notes Western BlotThis is a rabbit polyclonal antibody against GOSR1 and was validated on Western blot.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment Store at -20°C. Avoid freeze-thaw cycles.
Supplier Images
Western Blotting (WB) image for anti-Golgi SNAP Receptor Complex Member 1 (GOSR1) (C-Term) antibody (ABIN4960978) Western Blot: GOSR1 Antibody - Titration: 0.2-1 ug/ml, Positive Control: Human Liver.