Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501250

Mediator Complex Subunit 6 (MED6) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1500012F11Rik, AU019660, AV213303, NY-REN-28
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501250
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MED6 antibody: synthetic peptide directed towards the middle region of human MED6
Sequence ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETV KPEEKETTKN
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 92%, Rabbit : 92%, Rat : 92%, Pig : 86%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against MED6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MED6
Background MED6 is a component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. And mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Molecular Weight 28kDa
Gene ID 10001
NCBI Accession NP_005457, NM_005466
UniProt O75586
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MED6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pavri, Lewis, Kim et al.: "PARP-1 determines specificity in a retinoid signaling pathway via direct modulation of mediator." in: Molecular cell, Vol. 18, Issue 1, pp. 83-96, 2005 (PubMed).

Alternatives for antigen "Mediator Complex Subunit 6 (MED6)", type "Antibodies"
Hosts (16), (7)
Reactivities (23), (5), (4), (2), (2), (1), (1), (1), (1), (1)
Applications (23), (9), (4), (2)
Epitopes (5), (5), (3), (2), (2), (2), (2), (2), (2), (1), (1)
Beacon