Did you know that you can buy products from over 140 different suppliers from us?

Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 2 (PSMC2) (N-Term) antibody

Details for Product No. ABIN501257
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MSS1, xMSS1, Nbla10058, S7, zgc:63995, NCU02840.1, An02g12760, 23.m06337, AO090020000414, DDBDRAFT_0168337, DDBDRAFT_0232966, DDB_0168337, DDB_0232966, psmc2
Epitope
N-Term
(11), (9), (6), (3), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Xenopus laevis, Fruit Fly (Drosophila melanogaster), Human, Chicken
(53), (18), (18), (13), (1), (1), (1), (1)
Host
Rabbit
(38), (14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(42), (25), (10), (8), (7), (7), (4), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501257
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PSMC2
Sequence MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQST YSRQIKQVED
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Horse : 90 %, Mouse : 90 %, African clawed frog : 80 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PSMC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PSMC2
Background The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex. In case of HIV-1 infection, PSMC2 is a positive modulator of Tat-mediated transactivation.The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This subunit may also compete with PSMC3 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex.
Molecular Weight 49 kDa
Gene ID 5701
NCBI Accession NM_002803, NP_002794
UniProt P35998
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 433 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 2 (PSMC2) (N-Term) antibody WB Suggested Anti-PSMC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate
Background publications Tu, Yan, Hood et al.: "Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells." in: Molecular & cellular proteomics : MCP, Vol. 6, Issue 4, pp. 575-88, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501257
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top