Tripartite Motif Containing 62 (TRIM62) (N-Term) antibody

Details for Product No. ABIN501303
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms DEAR1, AI450348, 6330414G21Rik, zgc:158653, TRIM62, trim62, MGC115263, dear1
Epitope
N-Term
(3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(10), (4), (2), (2), (2), (1)
Host
Rabbit
(10)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10)
Pubmed 1 reference available
Catalog no. ABIN501303
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRIM62
Sequence RALLCFFCDEPALHEQHQVTGIDDAFDELQRELKDQLQAL QDSEREHTEA
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %, Mouse : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against TRIM62. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIM62
Background TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.
Molecular Weight 54 kDa
Gene ID 55223
NCBI Accession NM_018207, NP_060677
UniProt Q9BVG3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 475 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1...." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Hosts (10)
Reactivities (10), (4), (2), (2), (2), (1)
Applications (10)
Epitopes (3), (2), (2), (1), (1), (1)
back to top