Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501303

Tripartite Motif Containing 62 (TRIM62) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DEAR1, AI450348, 6330414G21Rik, zgc:158653, TRIM62, trim62, MGC115263, dear1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501303
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIM62 antibody: synthetic peptide directed towards the N terminal of human TRIM62
Sequence RALLCFFCDEPALHEQHQVTGIDDAFDELQRELKDQLQAL QDSEREHTEA
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Mouse : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against TRIM62. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIM62
Background TRIM62 contains 1 RING-type zinc finger, which is probably involved in mediating protein-protein interactions. RING-type zinc finger was identified in a group of proteins with a wide range of functions such as viral replication, signal transduction, and development. But the function of TRIM62 remains unknown.
Molecular Weight 54kDa
Gene ID 55223
NCBI Accession NP_060677, NM_018207
UniProt Q9BVG3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIM62 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 62 (TRIM62)", type "Antibodies"
Hosts (11), (2)
Reactivities (13), (5), (2), (2), (2), (1)
Applications (13), (2), (2), (1)
Epitopes (3), (3), (2), (2), (1), (1), (1)
Beacon