PR Domain Containing 11 (PRDM11) (Middle Region) antibody

Details for Product No. ABIN501309
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1305673, PFM8, 8030443D09Rik, AA163972, Gm707
Epitope
Middle Region
(4), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(12)
Host
Rabbit
(6), (5), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (6), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501309
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PRDM11
Sequence PGEWLRVWYSEDYMKRLHSMSQETIHRNLARGEKRLQREK SEQVLDNPED
Predicted Reactivity Dog : 92 %, Pig : 92 %, Rabbit : 92 %, Bovine : 82 %, Guinea pig : 82 %, Horse : 82 %, Mouse : 82 %
Characteristics This is a rabbit polyclonal antibody against PRDM11. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PRDM11
Background The specific function of this protein remains unknown.
Molecular Weight 58 kDa
Gene ID 56981
NCBI Accession NM_020229, NP_064614
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 511 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Xiao, Wilson, Gamblin: "SET domains and histone methylation." in: Current opinion in structural biology, Vol. 13, Issue 6, pp. 699-705, 2003 (PubMed).

Validation Images
back to top