Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501309

PR Domain Containing 11 (PRDM11) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PFM8, Gm707, AA163972, 8030443D09Rik, RGD1305673
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501309
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRDM11 antibody: synthetic peptide directed towards the middle region of human PRDM11
Sequence PGEWLRVWYSEDYMKRLHSMSQETIHRNLARGEKRLQREK SEQVLDNPED
Predicted Reactivity Dog : 92%, Pig : 92%, Rabbit : 92%, Bovine : 85%, Guinea pig : 85%, Horse : 85%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against PRDM11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PRDM11
Background The specific function of this protein remains unknown.
Molecular Weight 58kDa
Gene ID 56981
NCBI Accession NP_064614, NM_020229
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRDM11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Xiao, Wilson, Gamblin: "SET domains and histone methylation." in: Current opinion in structural biology, Vol. 13, Issue 6, pp. 699-705, 2003 (PubMed).

Alternatives for antigen "PR Domain Containing 11 (PRDM11)", type "Antibodies"
Hosts (6), (6), (1)
Reactivities (12)
Applications (11), (6), (2), (1)
Epitopes (4), (1)
Beacon