Did you know that you can buy products from over 140 different suppliers from us?

Kv Channel Interacting Protein 4 (KCNIP4) (N-Term) antibody

Details for Product No. ABIN501313
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KCHIP4.2, KCNIP4, MGC115522, DKFZp459M1362, CALP, KCHIP4, Calp, KChIP4, Calp250, KChIP4a, AV032399, Kchip4
Epitope
N-Term
(15), (8), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(22), (8), (4), (1), (1)
Host
Rabbit
(21), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (12), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501313
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KCNIP4
Sequence NVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLL PCSAAKTSSP
Predicted Reactivity Dog : 100 %, Human : 100 %, Rabbit : 100 %, Mouse : 90 %
Characteristics This is a rabbit polyclonal antibody against KCNIP4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCNIP4
Background KCNIP4 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Molecular Weight 29 kDa
Gene ID 80333
NCBI Accession NM_025221, NP_079497
UniProt Q6PIL6
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 250 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501313
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top