Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501324

Paired Box 8 (PAX8) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PAX-8, XPax8, pax-8, PAX8, XPax-8
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN501324
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the middle region of human PAX8
Sequence SSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSH TKGEQGERWW
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against PAX8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PAX8
Background PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development
Molecular Weight 35kDa
Gene ID 7849
NCBI Accession NP_039247, NM_013953
UniProt Q06710-4
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PAX8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nonaka, Tang, Chiriboga et al.: "Diagnostic utility of thyroid transcription factors Pax8 and TTF-2 (FoxE1) in thyroid epithelial neoplasms." in: Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, Vol. 21, Issue 2, pp. 192-200, 2008 (PubMed).

Alternatives for antigen "Paired Box 8 (PAX8)", type "Antibodies"
Hosts (45), (29), (16)
Reactivities (84), (30), (29), (16), (15), (2), (2), (1), (1), (1), (1)
Applications (68), (46), (16), (13), (10), (6), (6), (6), (6), (5), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (8), (5), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon