Paired Box 8 (PAX8) (Middle Region) antibody

Details for Product No. ABIN501324
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms PAX-8, XPax8, pax-8, PAX8, XPax-8
Epitope
Middle Region
(9), (8), (5), (4), (4), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(82), (28), (27), (15), (14), (3), (1), (1), (1)
Host
Rabbit
(46), (30), (14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(69), (43), (15), (13), (10), (6), (6), (6), (6), (4), (3), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501324
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PAX8
Sequence SSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSH TKGEQGERWW
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against PAX8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PAX8
Background PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development
Molecular Weight 35 kDa
Gene ID 7849
NCBI Accession NM_013953, NP_039247
UniProt Q06710-4
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 321 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Paired Box 8 (PAX8) (Middle Region) antibody WB Suggested Anti-PAX8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: NCI-H226 cell lysate
anti-Paired Box 8 (PAX8) (Middle Region) antibody (2) anti-Paired Box 8 (PAX8) (Middle Region) antibody (Image 2)
Background publications Nonaka, Tang, Chiriboga et al.: "Diagnostic utility of thyroid transcription factors Pax8 and TTF-2 (FoxE1) in thyroid epithelial neoplasms." in: Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, Vol. 21, Issue 2, pp. 192-200, 2008 (PubMed).

Hosts (46), (30), (14)
Reactivities (82), (28), (27), (15), (14), (3), (1), (1), (1)
Applications (69), (43), (15), (13), (10), (6), (6), (6), (6), (4), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (8), (5), (4), (4), (2), (1), (1), (1), (1), (1), (1), (1), (1)
back to top