Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501374

Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 4 (KCNC4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C1orf30, HKSHIIIC, KSHIIIC, KV3.4, AI850292, Kcr2-4, Kv3.4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN501374
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCNC4 antibody: synthetic peptide directed towards the middle region of human KCNC4
Sequence NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLW FTLEFLVRIV
Predicted Reactivity Human : 100%, Guinea pig : 92%, Mouse : 92%, Rat : 92%, Bovine : 85%, Horse : 85%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against KCNC4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCNC4
Background KCNC4 is part of the Shaker gene family of Drosophila. It encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. KCNC4 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Several transcript variants encoding different isoforms have been found for this gene.The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes. It generates atypical voltage-dependent transient current that may be important for neuronal excitability. Several transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 64kDa
Gene ID 3749
NCBI Accession NP_720198, NM_153763
UniProt Q03721-2
Research Area Neurology, Alzheimer's Disease
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCNC4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "Potassium Voltage-Gated Channel, Shaw-Related Subfamily, Member 4 (KCNC4)", type "Antibodies"
Hosts (38), (8)
Reactivities (37), (22), (21), (12), (12), (12)
Applications (37), (22), (16), (10), (9), (6), (5), (4), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (6), (5), (2), (2), (2), (1), (1)
Beacon