Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10) (N-Term) antibody

Details for Product No. ABIN501379
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Kcn1, Kv1.8, Kcna8, Gm1962, cKv1.2
Epitope
N-Term
(8), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(13), (8), (8), (1)
Host
Rabbit
(15)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(15), (10), (8), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN501379
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KCNA10
Sequence DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRP GGSSFSNGKI
Predicted Reactivity Bovine : 92 %, Mouse : 82 %, Rat : 82 %, Horse : 82 %
Characteristics This is a rabbit polyclonal antibody against KCNA10. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCNA10
Background KCNA10 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.
Molecular Weight 58 kDa
Gene ID 3744
NCBI Accession NM_005549, NP_005540
UniProt Q16322
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 511 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10) (N-Term) antibody WB Suggested Anti-KCNA10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10) (N-Term) antibody (2) anti-Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10) (N-Term) antibody (Image 2)
Background publications Gutman, Chandy, Grissmer et al.: "International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 473-508, 2005 (PubMed).

Hosts (15)
Reactivities (13), (8), (8), (1)
Applications (15), (10), (8), (2), (1)
Epitopes (8), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top