Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501379

Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Kcn1, Kv1.8, Kcna8, Gm1962, cKv1.2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN501379
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the N terminal of human KCNA10
Sequence DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRP GGSSFSNGKI
Predicted Reactivity Bovine : 92%, Mouse : 85%, Rat : 85%, Horse : 84%
Characteristics This is a rabbit polyclonal antibody against KCNA10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCNA10
Background KCNA10 is a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP. This gene is intronless, and the gene is clustered with genes KCNA2 and KCNA3 on chromosome 1.
Molecular Weight 58kDa
Gene ID 3744
NCBI Accession NP_005540, NM_005549
UniProt Q16322
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCNA10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gutman, Chandy, Grissmer et al.: "International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 473-508, 2005 (PubMed).

Alternatives for antigen "Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 10 (KCNA10)", type "Antibodies"
Hosts (15)
Reactivities (13), (8), (8), (1)
Applications (15), (10), (7), (2), (2)
Epitopes (8), (2), (1), (1)
Beacon