Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) antibody
| Antigen | Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) |
| Synonyms | MYSB, CAVB2, CACNLB2, FLJ23743, Cchb2, AW060387, Cavbeta2, MGC129334, MGC129335, Cacnlb2, CACNB2, CAB2, Cacnb2, DKFZp468H0713 |
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine) |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
![]() |
1 reference available |
| Catalog no. | ABIN501435 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | CACNB2 |
| Gene ID | CACNB2 |
| UniProt | Q08289-2 |
| Immunogen | The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2 |
| Sequence | AYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGS QGDQRTDRSA |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rabbit, Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-CACNB2 antibody concentration is 1 mg/ml. |
| Description | CACNB2 belongs to the calcium channel beta subunit family.The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and ina |
| Characteristics | Antigen Size: 605 amino acids |
| Molecular Weight | 68kDa |
Application Details
| Application Notes |
WB Suggested Anti-CACNB2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human kidney. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Neurology |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-CACNB2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human kidney |
Publications
| Product |
Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).
|
Alternatives
Alternatives for antigen "Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2)", type "Antibodies"




Alternatives