Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) antibody

Antigen

Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2)
Synonyms MYSB, CAVB2, CACNLB2, FLJ23743, Cchb2, AW060387, Cavbeta2, MGC129334, MGC129335, Cacnlb2, CACNB2, CAB2, Cacnb2, DKFZp468H0713
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN501438
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name CACNB2
Gene ID CACNB2
UniProt Q08289
Immunogen The immunogen for anti-CACNB2 antibody: synthetic peptide directed towards the middle region of human CACNB2
Sequence ADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIF ELARTLQLVV
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CACNB2 antibody concentration is 1 mg/ml.
Description CACNB2 belongs to the calcium channel beta subunit family.The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and ina
Characteristics Antigen Size: 660 amino acids
Molecular Weight 73kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-CACNB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Neurology
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2)", type "Antibodies"
Hosts Rabbit (60), Mouse (9), Goat (3)
Reactivities Human (57), Mouse (Murine) (32), Rat (Rattus) (32), Dog (Canine) (25), Chicken (20), Horse (Equine) (18), Cow (Bovine) (10), Rabbit (8), Xenopus laevis (2)
Applications Western Blotting (WB) (52), Immunofluorescence (IF) (16), ELISA (15), Immunohistochemistry (IHC) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunoprecipitation (IP) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (2), Immunostaining (ISt) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Fixed) (IHC (fx)) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (7), Internal Region (7), N-Term (2), AA 189-205 (1), AA 213-301 (1), AA 565-579 (1), C-Term,AA 565-579 (1), Center (1)