Zinc Finger Protein 124 (ZNF124) (Middle Region) antibody

Details for Product No. ABIN501442
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms HZF-16, HZF16, ZK7, Znf124, Znf763
Epitope
Middle Region
(3), (3), (2), (2), (2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Human
(14), (1), (1), (1), (1), (1)
Host
Rabbit
(8), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN501442
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF124
Sequence KAFSCLSSLQGHIKAHAGEEPYPCKQCGKAFRYASSLQKH EKTHIAQKPY
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF124. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF124
Background The exact function of ZNF124 remains unknown.
Molecular Weight 33 kDa
Gene ID 7678
NCBI Accession NM_003431, NP_003422
UniProt B3KNP3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 289 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1...." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Hosts (8), (6)
Reactivities (14), (1), (1), (1), (1), (1)
Applications (14), (4), (3), (2)
Epitopes (3), (3), (2), (2), (2), (1)
back to top