Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 510 (ZNF510) (N-Term) antibody

Details for Product No. ABIN501475
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(9), (7), (2), (1), (1)
Reactivity
Human
(12), (1), (1), (1), (1)
Host
Rabbit
(12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (6)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501475
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF510
Sequence SEEEFSNQSHPKDYRGDDLIKQNKKIKDKHLEQAICINNK TLTTEEEKVL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF510. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF510
Background ZNF510 may be involved in transcriptional regulation.
Molecular Weight 79 kDa
Gene ID 22869
NCBI Accession NM_014930, NP_055745
UniProt Q9Y2H8
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 683 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Validation Images
back to top