Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501475

Zinc Finger Protein 510 (ZNF510) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501475
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF510 antibody: synthetic peptide directed towards the N terminal of human ZNF510
Sequence SEEEFSNQSHPKDYRGDDLIKQNKKIKDKHLEQAICINNK TLTTEEEKVL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF510. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF510
Background ZNF510 may be involved in transcriptional regulation.
Molecular Weight 79kDa
Gene ID 22869
NCBI Accession NP_055745, NM_014930
UniProt Q9Y2H8
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF510 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 510 (ZNF510)", type "Antibodies"
Hosts (6)
Reactivities (6), (1), (1), (1), (1)
Applications (6), (1)
Epitopes (4), (2), (1), (1), (1)
Beacon