Zinc Finger Protein 510 (ZNF510) (N-Term) antibody

Details for Product No. ABIN501475
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
(3), (2), (1), (1), (1)
Reactivity
Human
(6), (1), (1), (1), (1)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6)
Pubmed 1 reference available
Catalog no. ABIN501475
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF510
Sequence SEEEFSNQSHPKDYRGDDLIKQNKKIKDKHLEQAICINNK TLTTEEEKVL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF510. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF510
Background ZNF510 may be involved in transcriptional regulation.
Molecular Weight 79 kDa
Gene ID 22869
NCBI Accession NM_014930, NP_055745
UniProt Q9Y2H8
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 683 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Hosts (6)
Reactivities (6), (1), (1), (1), (1)
Applications (6)
Epitopes (3), (2), (1), (1), (1)
back to top