Early B-Cell Factor 2 (EBF2) (Middle Region) antibody

Details for Product No. ABIN501493
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms D14Ggc1e, EBF-2, Mmot1, O/E-3, OE-3, COE2, Zcoe2, EBF2
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(17), (14), (13), (13), (12), (12), (1), (1)
Host
Rabbit
(16), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (4), (4), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501493
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EBF2
Sequence GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADI AEALYSVPRN
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against EBF2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EBF2
Background EBF2 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors.EBF2 belongs to the conserved Olf/EBF family (see MIM 164343) of helix-loop-helix transcription factors (Wang et al., 2002 [PubMed 12139918]).
Molecular Weight 63 kDa
Gene ID 64641
NCBI Accession NM_022659, NP_073150
UniProt Q9HAK2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 575 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Early B-Cell Factor 2 (EBF2) (Middle Region) antibody WB Suggested Anti-EBF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate
Background publications Nusbaum, Mikkelsen, Zody et al.: "DNA sequence and analysis of human chromosome 8...." in: Nature, Vol. 439, Issue 7074, pp. 331-5, 2006 (PubMed).

Hosts (16), (1), (1)
Reactivities (17), (14), (13), (13), (12), (12), (1), (1)
Applications (10), (9), (4), (4), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1), (1)
back to top