Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501493

Early B-Cell Factor 2 (EBF2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms D14Ggc1e, EBF-2, Mmot1, O/E-3, OE-3, COE2, Zcoe2, EBF2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501493
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EBF2 antibody: synthetic peptide directed towards the middle region of human EBF2
Sequence GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADI AEALYSVPRN
Predicted Reactivity Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against EBF2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EBF2
Background EBF2 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors.EBF2 belongs to the conserved Olf/EBF family (see MIM 164343) of helix-loop-helix transcription factors (Wang et al., 2002 [PubMed 12139918]).
Molecular Weight 63kDa
Gene ID 64641
NCBI Accession NP_073150, NM_022659
UniProt Q9HAK2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EBF2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nusbaum, Mikkelsen, Zody et al.: "DNA sequence and analysis of human chromosome 8." in: Nature, Vol. 439, Issue 7074, pp. 331-5, 2006 (PubMed).

Alternatives for antigen "Early B-Cell Factor 2 (EBF2)", type "Antibodies"
Hosts (15), (1)
Reactivities (15), (14), (13), (13), (12), (12), (1), (1)
Applications (10), (7), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Beacon