Zinc Finger Protein 329 (ZNF329) (N-Term) antibody

Details for Product No. ABIN501495
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF329, 2810439M05Rik, 4632409L22Rik
Epitope
N-Term
(9), (3), (1), (1)
Reactivity
Human
(22), (1), (1)
Host
Rabbit
(21), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(22), (10), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501495
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF329
Sequence GDGWDCENQEGHLRQSALTLEKPGTQEAICEYPGFGEHLI ASSDLPPSQR
Predicted Reactivity Rabbit : 85 %
Characteristics This is a rabbit polyclonal antibody against ZNF329. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF329
Background The function of ZNF329 remains unknown.
Molecular Weight 62 kDa
Gene ID 79673
NCBI Accession NM_024620, NP_078896
UniProt Q86UD4
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 541 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 329 (ZNF329) (N-Term) antibody WB Suggested Anti-ZNF329 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (21), (1)
Reactivities (22), (1), (1)
Applications (22), (10), (1), (1), (1)
Epitopes (9), (3), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top