Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501495

Zinc Finger Protein 329 (ZNF329) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF329, 2810439M05Rik, 4632409L22Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501495
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF329 antibody: synthetic peptide directed towards the N terminal of human ZNF329
Sequence GDGWDCENQEGHLRQSALTLEKPGTQEAICEYPGFGEHLI ASSDLPPSQR
Predicted Reactivity Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against ZNF329. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF329
Background The function of ZNF329 remains unknown.
Molecular Weight 62kDa
Gene ID 79673
NCBI Accession NP_078896, NM_024620
UniProt Q86UD4
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF329 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 329 (ZNF329)", type "Antibodies"
Hosts (18)
Reactivities (18), (1), (1)
Applications (18), (7), (1), (1)
Epitopes (7), (3), (1), (1)
Beacon