Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501510

CCCTC-Binding Factor (Zinc Finger Protein)-Like (CTCFL) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Boris, OTTMUSG00000016680, BORIS, CT27, CTCF-T, HMGB1L1, dJ579F20.2, CTCFL, im:7152666, CTCF, xctcf
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501510
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CTCFL antibody: synthetic peptide directed towards the N terminal of human CTCFL
Sequence CREKDHRSPSELEAERTSGAFQDSVLEEEVELVLAPSEES EKYILTLQTV
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against CTCFL. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CTCFL
Background CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. CTCFL is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and CTCFL are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation.CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. This gene is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and the protein encoded by this gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation.
Molecular Weight 76kDa
Gene ID 140690
NCBI Accession NP_542185, NM_080618
UniProt Q8NI51
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CTCFL antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Sun, Huang, Nguyen et al.: "DNA methyltransferase 1 and 3B activate BAG-1 expression via recruitment of CTCFL/BORIS and modulation of promoter histone methylation." in: Cancer research, Vol. 68, Issue 8, pp. 2726-35, 2008 (PubMed).

Alternatives for antigen "CCCTC-Binding Factor (Zinc Finger Protein)-Like (CTCFL)", type "Antibodies"
Hosts (26), (2)
Reactivities (25), (18), (16), (12), (12), (12), (1)
Applications (19), (10), (9), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (3), (3), (1)
Beacon