Zinc Finger Protein 683 (ZNF683) (N-Term) antibody

Details for Product No. ABIN501527
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF683
Epitope
N-Term
(3), (1)
Reactivity
Human
(7)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (4), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501527
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF683
Sequence KEESAAQLGCCHRPMALGGTGGSLSPSLDFQLFRGDQVFS ACRPLPDMVD
Predicted Reactivity Horse : 100 %, Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF683. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF683
Background This gene, ZNF683, which is located on chromosome 1, is predicted to encode a zinc finger protein, currently with unknown fucntion.
Molecular Weight 54 kDa
Gene ID 257101
NCBI Accession NM_173574, NP_775845
UniProt Q8IZ20
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 504 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 683 (ZNF683) (N-Term) antibody WB Suggested Anti-ZNF683 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1...." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Hosts (6), (1)
Reactivities (7)
Applications (7), (4), (1), (1)
Epitopes (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top