Did you know that you can buy products from over 140 different suppliers from us?

DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (N-Term) antibody

Details for Product No. ABIN501553
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ddx47, DDX47, E4-DBP, HQ0256, MSTP162, RRP3, 4930588A18Rik, C77285
Epitope
N-Term
(10), (6), (5), (3), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Human
(25), (5), (3), (3), (2), (2), (1), (1), (1)
Host
Rabbit
(22), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(26), (8), (6), (3), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501553
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DDX47
Sequence AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQ LGWTKPTKIQ
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Horse : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against DDX47. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DDX47
Background DDX47 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX47 can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene can shuttle between the nucleus and the cytoplasm, and has an RNA-independent ATPase activity. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Weight 50 kDa
Gene ID 51202
NCBI Accession NM_016355, NP_057439
UniProt Q9H0S4
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 455 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47) (N-Term) antibody WB Suggested Anti-DDX47 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Validation Images
back to top