Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501587

Adenosine Deaminase, RNA-Specific (ADAR) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ADAR1, AGS6, DRADA, DSH, DSRAD, G1P1, IFI-4, IFI4, K88DSRBP, P136, AV242451, Adar1, mZaADAR, red1, drada, wu:fc22a02, adar1, dsRAD, dsRAD-1, ADAR, CG12598, Dmel\\CG12598, EG:BACN35H14.1, adar, adr, cg ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN501587
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ADAR antibody: synthetic peptide directed towards the N terminal of human ADAR
Sequence GEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAG TPPLWKIAVS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ADAR. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ADAR
Background ADAR is responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molecular Weight 136kDa
Gene ID 103
NCBI Accession NP_001102, NM_001111
UniProt P55265
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ADAR antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Pan, Ye, Franco et al.: "Insulin resistance and depressive symptoms in middle-aged and elderly Chinese: findings from the Nutrition and Health of Aging Population in China Study." in: Journal of affective disorders, Vol. 109, Issue 1-2, pp. 75-82, 2008 (PubMed).

Background publications Zhang, Liu, Jiang et al.: "Six novel mutations of the ADAR1 gene in Chinese patients with dyschromatosis symmetrica hereditaria." in: Journal of dermatological science, Vol. 50, Issue 2, pp. 109-14, 2008 (PubMed).

Alternatives for antigen "Adenosine Deaminase, RNA-Specific (ADAR)", type "Antibodies"
Hosts (38), (3), (1)
Reactivities (38), (22), (19), (2)
Applications (20), (17), (14), (7), (6), (4), (2), (2), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (13), (13), (2), (1)
Beacon