Did you know that you can buy products from over 140 different suppliers from us?

Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) (N-Term) antibody

Details for Product No. ABIN501591
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CACNLB2, CAVB2, MYSB, AW060387, CAB2, Cavbeta2, Cchb2, Cacnlb2, Cacnb2, CACNB2
Epitope
N-Term
(19), (12), (9), (8), (8), (7), (3), (3)
Reactivity
Human
(68), (47), (29), (18), (14), (9), (8), (2), (2)
Host
Rabbit
(64), (32), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(85), (22), (22), (19), (17), (10), (4), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501591
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the n terminal of human CACNB2
Sequence IQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTS SDTTSNSFVR
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against CACNB2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CACNB2
Background CACNB2 belongs to the calcium channel beta subunit family.The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.Defects in CACNB2 are the cause of Brugada syndrome type 4 (BRS4).
Molecular Weight 73 kDa
Gene ID 783
NCBI Accession NM_201596, NP_963890
UniProt Q08289
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 660 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2) (N-Term) antibody WB Suggested Anti-CACNB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501591
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top