Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501612

Zinc Finger Protein 276 (ZNF276) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CENP-Z, CENPZ, ZFP276, ZNF477, AW048709, D8Ertd370e, D8Ertd377e, Znf276, ZNF276
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501612
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF276 antibody: synthetic peptide directed towards the middle region of human ZNF276
Sequence SALAVKWPWDKETAPRLPQHRGWNPGDAPQTSQGRGTGTP VGAETKTLPS
Predicted Reactivity Human :100%,   Crab-eating macaque :92%,   Rice :91%,  
Characteristics This is a rabbit polyclonal antibody against ZNF276. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF276
Background The exact function of this protein remains unknown.
Molecular Weight 60kDa
Gene ID 92822
NCBI Accession NP_689500, NM_152287
UniProt Q8N554-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF276 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "Zinc Finger Protein 276 (ZNF276)", type "Antibodies"
Hosts (12), (1)
Reactivities (13), (2), (2), (2), (1)
Applications (13), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1), (1), (1)
Beacon