Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501643

Interferon Regulatory Factor 4 (IRF4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LSIRF, MUM1, NF-EM5, Spip, IRF-4, AI385587, si:ch73-170d1.2, IRF4, irf4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501643
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IRF4 antibody: synthetic peptide directed towards the middle region of human IRF4
Sequence TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYH RSIRHSSIQE
Predicted Reactivity Chicken : 100%, Dog : 100%, Human : 100%, Guinea pig : 92%, Horse : 92%, Rabbit : 85%, Pig : 83%
Characteristics This is a rabbit polyclonal antibody against IRF4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IRF4
Background IRF4 is a transcriptional activator. It binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter.It also binds the immunoglobulin lambda light chain enhancer, together with PU.1. IRF4 probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells.
Molecular Weight 52kDa
Gene ID 3662
NCBI Accession NP_002451, NM_002460
UniProt Q15306
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IRF4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Han, Kraft, Nan et al.: "A genome-wide association study identifies novel alleles associated with hair color and skin pigmentation." in: PLoS genetics, Vol. 4, Issue 5, pp. e1000074, 2008 (PubMed).

Alternatives for antigen "Interferon Regulatory Factor 4 (IRF4)", type "Antibodies"
Hosts (65), (24), (3), (1), (1)
Reactivities (92), (36), (24), (14), (14), (2), (2), (2), (1)
Applications (69), (35), (35), (10), (10), (7), (5), (3), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (6), (6), (5), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon