Interferon Regulatory Factor 4 (IRF4) (Middle Region) antibody

Details for Product No. ABIN501643
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LSIRF, MUM1, NF-EM5, Spip, IRF-4, AI385587, si:ch73-170d1.2, IRF4, irf4
Epitope
Middle Region
(13), (6), (5), (5), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Human, Chicken
(91), (42), (29), (14), (14), (2), (2), (2), (1)
Host
Rabbit
(71), (19), (3), (1), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(76), (38), (30), (12), (10), (5), (4), (4), (2), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501643
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human IRF4
Sequence TAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYH RSIRHSSIQE
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Human : 100 %, Guinea pig : 90 %, Horse : 90 %, Rabbit : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against IRF4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name IRF4
Background IRF4 is a transcriptional activator. It binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter.It also binds the immunoglobulin lambda light chain enhancer, together with PU.1. IRF4 probably plays a role in ISRE-targeted signal transduction mechanisms specific to lymphoid cells.
Molecular Weight 52 kDa
Gene ID 3662
NCBI Accession NM_002460, NP_002451
UniProt Q15306
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 451 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Interferon Regulatory Factor 4 (IRF4) (Middle Region) antibody WB Suggested Anti-IRF4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Product cited in: Han, Kraft, Nan et al.: "A genome-wide association study identifies novel alleles associated with hair color and skin pigmentation." in: PLoS genetics, Vol. 4, Issue 5, pp. e1000074, 2008 (PubMed).

Hosts (71), (19), (3), (1), (1)
Reactivities (91), (42), (29), (14), (14), (2), (2), (2), (1)
Applications (76), (38), (30), (12), (10), (5), (4), (4), (2), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (6), (5), (5), (5), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top