Did you know that you can buy products from over 140 different suppliers from us?

Ring Finger Protein 1 (RING1) (Middle Region) antibody

Details for Product No. ABIN501649
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RING1A, RNF1, Ring1A
Epitope
Middle Region
(9), (9), (7), (5), (3), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(66), (25), (24), (15), (14), (14), (12)
Host
Rabbit
(44), (22)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(57), (29), (10), (7), (7), (4), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501649
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RING1
Sequence SDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTI YIAPGGGAFT
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against RING1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RING1
Background RING1 can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain.This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4.
Molecular Weight 42 kDa
Gene ID 6015
NCBI Accession NM_002931, NP_002922
UniProt Q06587
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 406 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ring Finger Protein 1 (RING1) (Middle Region) antibody WB Suggested Anti-RING1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
Background publications van Leenders, Dukers, Hessels et al.: "Polycomb-group oncogenes EZH2, BMI1, and RING1 are overexpressed in prostate cancer with adverse pathologic and clinical features." in: European urology, Vol. 52, Issue 2, pp. 455-63, 2007 (PubMed).

Validation Images
back to top