Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501652

Helicase-Like Transcription Factor (HLTF) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Snf2l3, Smarca3, RUSH, SMARCA3, ZBU1, HLTF1, RNF80, HIP116, SNF2L3, HIP116A, P113, AF010600, BC057116, smarca3, wu:fc33f07, HLTF, MGC131155
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501652
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HLTF antibody: synthetic peptide directed towards the N terminal of human HLTF
Sequence SWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQD VIPPDDFLTS
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Mouse : 76%
Characteristics This is a rabbit polyclonal antibody against HLTF. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HLTF
Background SMARCA3 (HLTF) is a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. SMARCA3 contains a RING finger DNA binding motif. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.
Molecular Weight 114kDa
Gene ID 6596
NCBI Accession NP_003062, NM_003071
UniProt Q14527
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HLTF antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Unk, Hajdú, Fátyol et al.: "Human HLTF functions as a ubiquitin ligase for proliferating cell nuclear antigen polyubiquitination." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 10, pp. 3768-73, 2008 (PubMed).

Alternatives for antigen "Helicase-Like Transcription Factor (HLTF)", type "Antibodies"
Hosts (39), (7), (1)
Reactivities (45), (17), (16), (15), (14), (12), (2)
Applications (35), (12), (10), (9), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (5), (2), (1), (1), (1), (1), (1), (1)
Beacon