Transcription Factor 21 (TCF21) (C-Term) antibody

Details for Product No. ABIN501658
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TCF21, Pod-1, pod1, Tcf21, ACYPI002601, tcf21, 0610011B16Rik, CRN7, POD1, bHLHa23, Pod1, capsulin, epc, epicardin, Capsulin, Msf-1, Epicardin, zgc:123313
Epitope
C-Term
(12), (6), (4), (3), (3), (2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(28), (13), (13), (13), (12), (4), (1), (1), (1)
Host
Rabbit
(34)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(25), (10), (8), (7), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501658
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TCF21
Sequence RQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTAS RLCGTTAS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Rat : 100 %, Mouse : 80 %, African clawed frog : 70 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against TCF21. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TCF21
Background The TCF21 gene encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney.TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 20 kDa
Gene ID 6943
NCBI Accession NM_003206, NP_003197
UniProt O43680
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 179 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Smith, Lin, Brena et al.: "Epigenetic regulation of the tumor suppressor gene TCF21 on 6q23-q24 in lung and head and neck cancer." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 4, pp. 982-7, 2006 (PubMed).

Validation Images
back to top