Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501658

Transcription Factor 21 (TCF21) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms POD1, bHLHa23, epc, Pod1, Pod-1, capsulin, epicardin, Capsulin, Msf-1, Epicardin, pod1, TCF21, zgc:123313, Tcf21, ACYPI002601, tcf21
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501658
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCF21 antibody: synthetic peptide directed towards the C terminal of human TCF21
Sequence RQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTAS RLCGTTAS
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Rat : 100%, Mouse : 85%, African clawed frog : 78%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against TCF21. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TCF21
Background The TCF21 gene encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney.TCF21 encodes a transcription factor of the basic helix-loop-helix family. The TCF21 product is mesoderm specific, and expressed in embryonic epicardium, mesenchyme-derived tissues of lung, gut, gonad, and both mesenchymal and glomerular epithelial cells in the kidney. Two transcript variants encoding the same protein have been found for this gene.
Molecular Weight 20kDa
Gene ID 6943
NCBI Accession NP_003197, NM_003206
UniProt O43680
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCF21 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Smith, Lin, Brena et al.: "Epigenetic regulation of the tumor suppressor gene TCF21 on 6q23-q24 in lung and head and neck cancer." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 4, pp. 982-7, 2006 (PubMed).

Alternatives for antigen "Transcription Factor 21 (TCF21)", type "Antibodies"
Hosts (29)
Reactivities (26), (15), (15), (15), (12), (2), (1), (1), (1), (1), (1), (1)
Applications (20), (10), (7), (4), (4), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (3), (2), (2), (2)
Beacon