Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501662

Zinc Finger Protein 133 (ZNF133) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF150, pHZ-13, pHZ-66, Znf133
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunofluorescence (IF)
Pubmed 2 references available
Catalog no. ABIN501662
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF133 antibody: synthetic peptide directed towards the middle region of human ZNF133
Sequence KPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLPVQPDPEPC AGQPSDSLYS
Predicted Reactivity Human : 100%, Pig : 76%
Characteristics This is a rabbit polyclonal antibody against ZNF133. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF133
Background ZNF193 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 SCAN box domain. ZNF193 may be involved in transcriptional regulation.
Molecular Weight 73kDa
Gene ID 7692
NCBI Accession NP_003425, NM_003434
UniProt Q53XU1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF133 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Westphalen, Qayyum, Yeh et al.: "Liver fat: effect of hepatic iron deposition on evaluation with opposed-phase MR imaging." in: Radiology, Vol. 242, Issue 2, pp. 450-5, 2007 (PubMed).

Background publications Lee, Lee, Hahn et al.: "PIAS1 interacts with the KRAB zinc finger protein, ZNF133, via zinc finger motifs and regulates its transcriptional activity." in: Experimental & molecular medicine, Vol. 39, Issue 4, pp. 450-7, 2007 (PubMed).

Alternatives for antigen "Zinc Finger Protein 133 (ZNF133)", type "Antibodies"
Hosts (11), (8)
Reactivities (19), (1), (1), (1), (1)
Applications (19), (6), (5), (4), (1), (1)
Epitopes (7), (4), (3), (3), (1), (1)
Beacon