Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody

Details for Product No. ABIN501700, Supplier: Login to see New
New
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Xsim2, sim2-A, xSim, HMC13F06, HMC29C01, SIM, bHLHe15
Epitope
N-Term
(11), (5), (3), (2), (1), (1)
Reactivity
Chicken, Cow (Bovine), Dog (Canine), Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio)
(36), (30), (21)
Host
Rabbit
(25), (13), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(33), (23), (11), (3), (1), (1)
Pubmed 1 reference available
Supplier Login to see New
Catalog number from supplier Login to see New
Quantity 50 μg
Options
Shipping to United States ( )
Availability Will be delivered in 2 to 3 Business Days
Immunogen Synthetic peptide directed towards the N terminal of human SIM2
Blocking Peptide Blocking peptide for this product available: Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) peptide (ABIN983751)
Sequence MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKA SIIRLTTSYL
Predicted Reactivity African clawed frog : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against SIM2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SIM2 (SIM2 Antibody Abstract)
Background SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on t
Molecular Weight 73 kDa
Gene ID 6493
NCBI Accession NP_005060, NM_005069
UniProt Q14190
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 667 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
Image no. 1 for anti-Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody (ABIN501700) anti-Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody
Background publications Laffin, Wellberg, Kwak et al.: "Loss of singleminded-2s in the mouse mammary gland induces an epithelial-mesenchymal transition associated with up-regulation of slug and matrix metalloprotease 2." in: Molecular and cellular biology, Vol. 28, Issue 6, pp. 1936-46, 2008 (PubMed).

Catalog No. ABIN501700
$289.00
Plus shipping costs $45.00

Order hotline:

  • +1 877 302 8632
  • +1 888 205 9894 (TF)