Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody

Details for Product No. ABIN501700
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Xsim2, sim2-A, xSim, HMC13F06, HMC29C01, SIM, bHLHe15
Epitope
N-Term
(3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Pig (Porcine), Fruit Fly (Drosophila melanogaster), Human, Chicken
(26), (18), (17), (12), (12), (12)
Host
Rabbit
(18), (6), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (11), (10), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501700
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SIM2
Sequence MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKA SIIRLTTSYL
Predicted Reactivity African clawed frog : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against SIM2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SIM2
Background SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. The Drosophila sim gene encodes a transcription factor that is a master regulator of fruit fly neurogenesis. SIM2 maps within the so-called Down syndrome chromosomal region. Based on t
Molecular Weight 73 kDa
Gene ID 6493
NCBI Accession NM_005069, NP_005060
UniProt Q14190
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 667 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody anti-Single-Minded Homolog 2 (Drosophila) (SIM2) (N-Term) antibody
Background publications Laffin, Wellberg, Kwak et al.: "Loss of singleminded-2s in the mouse mammary gland induces an epithelial-mesenchymal transition associated with up-regulation of slug and matrix metalloprotease 2." in: Molecular and cellular biology, Vol. 28, Issue 6, pp. 1936-46, 2008 (PubMed).

Validation Images
back to top