Myocyte Enhancer Factor 2A (MEF2A) (N-Term) antibody

Details for Product No. ABIN501715
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ADCAD1, RSRFC4, RSRFC9, mef2, A430079H05Rik, mef2a, wu:fd19d02, adcad1, rsrfc4, rsrfc9, sl2, MEF2A, xmef2a
Epitope
N-Term
(34), (31), (29), (13), (5), (5), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Xenopus laevis, Cow (Bovine), Pig (Porcine), Human, Chicken
(206), (147), (134), (27), (26), (3), (2), (2), (1), (1), (1)
Host
Rabbit
(186), (24)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Application
Western Blotting (WB)
(119), (74), (72), (61), (49), (40), (12), (8), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501715
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MEF2A
Sequence GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDC EIALIIFNSS
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against MEF2A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MEF2A
Background The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)),a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain. The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression. The myogenic basic helix-loop-helix proteins, including myoD (MIM159970), myogenin (MIM 159980), MYF5 (MIM 159990), and MRF4 (MIM159991) are one class of identified factors. A second family of DNA binding regulatory proteins is the myocyte-specific enhancer factor-2 (MEF2) family. Each of these proteins binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)),a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain.The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression. The myogenic basic helix-loop-helix proteins, including myoD (MIM 159970), myogenin (MIM 159980), MYF5 (MIM 159990), and MRF4 (MIM 159991) are one class of identified factors. A second family of DNA binding regulatory proteins is the myocyte-specific enhancer factor-2 (MEF2) family. Each of these proteins binds to the MEF2 target DNA sequence present in the regulatory regions of many, if not all, muscle-specific genes. The MEF2 genes are members of the MADS gene family (named for the yeast mating type-specific transcription factor MCM1, the plant homeotic genes 'agamous' and 'deficiens' and the human serum response factor SRF (MIM 600589)), a family that also includes several homeotic genes and other transcription factors, all of which share a conserved DNA-binding domain.
Molecular Weight 55 kDa
Gene ID 4205
NCBI Accession NM_005587, NP_005578
UniProt Q02078
Research Area Cardiovascular, Hypertrophy, Cardiogenesis, Transcription Factors, Neurogenesis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 507 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ramachandran, Yu, Gulick: "Nuclear respiratory factor 1 controls myocyte enhancer factor 2A transcription to provide a mechanism for coordinate expression of respiratory chain subunits." in: The Journal of biological chemistry, Vol. 283, Issue 18, pp. 11935-46, 2008 (PubMed).

Hosts (186), (24)
Reactivities (206), (147), (134), (27), (26), (3), (2), (2), (1), (1), (1)
Applications (119), (74), (72), (61), (49), (40), (12), (8), (1), (1)
Conjugates (4), (4), (4), (4), (4), (4), (4), (4), (4), (4), (4)
Epitopes (34), (31), (29), (13), (5), (5), (4), (3), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top