Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 193 (ZNF193) (N-Term) antibody

Details for Product No. ABIN501737
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRD51, ZNF193
Epitope
N-Term
(7), (7), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(22), (1)
Host
Rabbit
(17), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (11), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501737
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF193
Sequence MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRL KRSNPLAREI
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF193. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF193
Background ZNF193 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 SCAN box domain. ZNF193 may be involved in transcriptional regulation.
Molecular Weight 46 kDa
Gene ID 7746
NCBI Accession NM_006299, NP_006290
UniProt O15535
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 394 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 193 (ZNF193) (N-Term) antibody WB Suggested Anti-ZNF193 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501737
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top