Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501737

Zinc Finger Protein 193 (ZNF193) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRD51, ZNF193
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501737
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF193 antibody: synthetic peptide directed towards the N terminal of human ZNF193
Sequence MNTNSKEVLSLGVQVPEAWEELLTMKVEAKSHLQWQESRL KRSNPLAREI
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF193. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF193
Background ZNF193 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers and 1 SCAN box domain. ZNF193 may be involved in transcriptional regulation.
Molecular Weight 46kDa
Gene ID 7746
NCBI Accession NP_006290, NM_006299
UniProt O15535
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF193 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 193 (ZNF193)", type "Antibodies"
Hosts (10), (5)
Reactivities (15), (1)
Applications (14), (6), (3), (2), (2), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon