Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501781

Zinc Finger Protein 337 (ZNF337) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501781
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF337 antibody: synthetic peptide directed towards the middle region of human ZNF337
Sequence TVHERIHTGERPYECQECGRKFSNKSYYSKHLKRHLREKR FCTGSVGEAS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF337. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF337
Background The function of ZNF337 has not yet been determined.
Molecular Weight 87kDa
Gene ID 26152
NCBI Accession NP_056470, NM_015655
UniProt Q9Y3M9
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF337 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 337 (ZNF337)", type "Antibodies"
Hosts (14)
Reactivities (13), (1), (1), (1), (1), (1), (1), (1)
Applications (13), (5), (1)
Epitopes (4), (2), (2), (2), (1)
Beacon