Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501819

Zinc Finger and BTB Domain Containing 2 (ZBTB2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gm1103, ZNF437
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501819
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB2 antibody: synthetic peptide directed towards the middle region of human ZBTB2
Sequence VKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLAS IKKEQETVLL
Predicted Reactivity Dog : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Bovine : 92%, Horse : 92%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against ZBTB2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB2
Background ZBTB2 may be involved in transcriptional regulation.
Molecular Weight 57kDa
Gene ID 57621
NCBI Accession NP_065912, NM_020861
UniProt Q8N680
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jung, Malovannaya, Wei et al.: "Proteomic analysis of steady-state nuclear hormone receptor coactivator complexes." in: Molecular endocrinology (Baltimore, Md.), Vol. 19, Issue 10, pp. 2451-65, 2005 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 2 (ZBTB2)", type "Antibodies"
Hosts (29)
Reactivities (29), (19), (19), (13), (12), (11), (11), (2), (2), (2), (1)
Applications (20), (12), (9), (6), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (4), (3), (2), (1), (1)
Beacon