Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger and BTB Domain Containing 2 (ZBTB2) (Middle Region) antibody

Details for Product No. ABIN501819
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gm1103, ZNF437
Epitope
Middle Region
(4), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(28), (19), (19), (12), (11), (11), (11), (1), (1), (1)
Host
Rabbit
(28)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (12), (9), (5), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501819
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZBTB2
Sequence VKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLAS IKKEQETVLL
Predicted Reactivity Dog : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Bovine : 90 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against ZBTB2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB2
Background ZBTB2 may be involved in transcriptional regulation.
Molecular Weight 57 kDa
Gene ID 57621
NCBI Accession NM_020861, NP_065912
UniProt Q8N680
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 514 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and BTB Domain Containing 2 (ZBTB2) (Middle Region) antibody WB Suggested Anti-ZBTB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: NCI-H226 cell lysate
Background publications Jung, Malovannaya, Wei et al.: "Proteomic analysis of steady-state nuclear hormone receptor coactivator complexes." in: Molecular endocrinology (Baltimore, Md.), Vol. 19, Issue 10, pp. 2451-65, 2005 (PubMed).

Hosts (28)
Reactivities (28), (19), (19), (12), (11), (11), (11), (1), (1), (1)
Applications (18), (12), (9), (5), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501819
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top