Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 70 (ZNF70) (N-Term) antibody

Details for Product No. ABIN501828
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Cos17
Epitope
N-Term
(5), (3), (3)
Reactivity
Human
(14), (2), (2), (2), (2)
Host
Rabbit
(8), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (6), (4), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501828
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF70
Sequence MEVPPATKFGETFAFENRLESQQGLFPGEDLGDPFLQERG LEQMAVIYKE
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF70. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF70
Background The function of the ZNF70 gene has not yet been determined
Molecular Weight 51 kDa
Gene ID 7621
NCBI Accession NM_021916, NP_068735
UniProt Q9UC06
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 446 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 70 (ZNF70) (N-Term) antibody WB Suggested Anti-ZNF70 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501828
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top