Did you know that you can buy products from over 140 different suppliers from us?

Highly Divergent Homeobox (HDX) (Middle Region) antibody

Details for Product No. ABIN501882
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CXorf43, D030011N01Rik, Gm380
Epitope
Middle Region
(2), (2), (1)
Reactivity
Dog (Canine), Human, Chicken
(5), (1), (1), (1), (1)
Host
Rabbit
(3), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501882
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HDX
Sequence MKADDKEQQQALLSDLPPELEEMDFNHASLEPDDTSFSVS SLSEKNVSES
Predicted Reactivity Human : 100 %, Dog : 90 %, Horse : 90 %, Rabbit : 90 %, Pig : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against HDX. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HDX
Background The function of this protein remains unknown.
Molecular Weight 77 kDa
Gene ID 139324
NCBI Accession NM_144657, NP_653258
UniProt Q7Z353
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 690 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Highly Divergent Homeobox (HDX) (Middle Region) antibody WB Suggested Anti-HDX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HT1080 cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Validation Images
back to top