Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501882

Highly Divergent Homeobox (HDX) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CXorf43, D030011N01Rik, Gm380
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501882
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HDX antibody: synthetic peptide directed towards the middle region of human HDX
Sequence MKADDKEQQQALLSDLPPELEEMDFNHASLEPDDTSFSVS SLSEKNVSES
Predicted Reactivity Human : 100%, Dog : 92%, Horse : 92%, Rabbit : 92%, Pig : 91%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against HDX. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HDX
Background The function of this protein remains unknown.
Molecular Weight 77kDa
Gene ID 139324
NCBI Accession NP_653258, NM_144657
UniProt Q7Z353
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HDX antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Highly Divergent Homeobox (HDX)", type "Antibodies"
Hosts (3), (2)
Reactivities (5), (1), (1), (1), (1)
Applications (5), (2), (2), (1)
Epitopes (2), (2), (1)
Beacon