Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501892

Zinc Finger Protein 572 (ZNF572) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501892
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF572 antibody: synthetic peptide directed towards the middle region of human ZNF572
Sequence PYKCTSCEKCFSRSAYLSQHRKIHVEKPFESPDVGDFPHE WTWKNCSGEM
Predicted Reactivity Human : 100%, Horse : 76%
Characteristics This is a rabbit polyclonal antibody against ZNF572. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF572
Background ZNF572 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 61kDa
Gene ID 137209
NCBI Accession NP_689625, NM_152412
UniProt Q7Z3I7
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF572 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 572 (ZNF572)", type "Antibodies"
Hosts (12)
Reactivities (12), (1)
Applications (12), (4), (4)
Epitopes (4), (2), (2), (2), (2), (1)
Beacon