Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 572 (ZNF572) (Middle Region) antibody

Details for Product No. ABIN501892
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(8), (7), (2), (2), (1)
Reactivity
Human
(18), (1)
Host
Rabbit
(17), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (8), (8), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501892
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF572
Sequence PYKCTSCEKCFSRSAYLSQHRKIHVEKPFESPDVGDFPHE WTWKNCSGEM
Predicted Reactivity Human : 100 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against ZNF572. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF572
Background ZNF572 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 61 kDa
Gene ID 137209
NCBI Accession NM_152412, NP_689625
UniProt Q7Z3I7
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 529 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 572 (ZNF572) (Middle Region) antibody WB Suggested Anti-ZNF572 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501892
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top