Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) (N-Term) antibody

Details for Product No. ABIN501931
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
G3PD, GAPD, Gapd, cb609, gapd, mg:bb02e05, wu:fb33a10, wu:ft80f05, KNC-NDS6, G3PDH, CG8893, Dmel\\CG8893, GA3PDH, GADPH, GAP, GAPDH, GAPDH II, GAPDH2, Gapdh, Gapdh-2, Gapdh13F, BEST:GH12586, CG12055,  ... show more
G3PD, GAPD, Gapd, cb609, gapd, mg:bb02e05, wu:fb33a10, wu:ft80f05, KNC-NDS6, G3PDH, CG8893, Dmel\\CG8893, GA3PDH, GADPH, GAP, GAPDH, GAPDH II, GAPDH2, Gapdh, Gapdh-2, Gapdh13F, BEST:GH12586, CG12055, Dmel\\CG12055, GAPDH I, GAPDH-1, GAPDH1, GAPDHI, Gapdh-1, Gapdh43E, gadph, gapdh, gapdh-1, gh12586, g3pd, GB14798, GAPC-2, GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE C-2, T6J4.17, T6J4_17, glyceraldehyde-3-phosphate dehydrogenase C2 show less
Epitope
N-Term
(83), (34), (13), (10), (6), (6), (5), (5), (5), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Human
(374), (219), (198), (96), (40), (29), (25), (24), (17), (17), (16), (14), (10), (9), (8), (8), (7), (6), (6), (6), (6), (5), (5), (4), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(256), (192), (32), (19), (15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(29), (21), (8), (6), (6), (6), (5), (5), (5), (5), (5), (5), (5), (5), (2), (2), (1), (1)
Application
Western Blotting (WB)
(423), (228), (123), (74), (72), (68), (49), (35), (18), (10), (5), (5), (4), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501931
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GAPDH
Sequence IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIF QERDPSKIKW
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Sheep : 100 %, Bovine : 90 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against GAPDH. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GAPDH
Background GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome.Glyceraldehyde-3-phosphate dehydrogenase catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. A GAPD pseudogene has been mapped to Xp21-p11 and 15 GAPD-like loci have been identified.
Molecular Weight 36 kDa
Gene ID 2597
NCBI Accession NM_002046, NP_002037
UniProt Q2TSD0
Research Area Cancer, Metabolism, Alzheimer's Disease, Enzymes
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 335 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) (N-Term) antibody WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
anti-Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) (N-Term) antibody (2) Sample Type: 3. rat brain extract (80ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science
Background publications Rinne, Clements, Lamme et al.: "A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes." in: Human molecular genetics, Vol. 17, Issue 13, pp. 1968-77, 2008 (PubMed).

Hosts (256), (192), (32), (19), (15)
Reactivities (374), (219), (198), (96), (40), (29), (25), (24), (17), (17), (16), (14), (10), (9), (8), (8), (7), (6), (6), (6), (6), (5), (5), (4), (3), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Applications (423), (228), (123), (74), (72), (68), (49), (35), (18), (10), (5), (5), (4), (3), (2), (2), (1), (1)
Conjugates (29), (21), (8), (6), (6), (6), (5), (5), (5), (5), (5), (5), (5), (5), (2), (2), (1), (1)
Epitopes (83), (34), (13), (10), (6), (6), (5), (5), (5), (4), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
back to top