Retinoic Acid Receptor, alpha (RARA) (N-Term) antibody

Details for Product No. ABIN501948
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RAR, NR1B1, Nr1b1, RARalpha1, nr1b1, rara2a, RAR-ALPHA1, HS-RARa, rar-alpha
Epitope
N-Term
(15), (11), (11), (10), (7), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(94), (54), (48), (8), (7), (2), (2), (1), (1)
Host
Rabbit
(67), (28), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(93), (57), (28), (23), (10), (8), (7), (4), (3), (3), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501948
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RARA
Sequence YESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYS TPLRTPLWNG
Predicted Reactivity Human : 100 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against RARA. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RARA
Background Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor, which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1, SMRT, and histone deacetylase. When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases, and the basic transcription machinery.
Molecular Weight 51 kDa
Gene ID 5914
NCBI Accession NM_001024809, NP_001019980
UniProt P10276-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 457 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Garapaty, Mahajan, Samuels: "Components of the CCR4-NOT complex function as nuclear hormone receptor coactivators via association with the NRC-interacting Factor NIF-1." in: The Journal of biological chemistry, Vol. 283, Issue 11, pp. 6806-16, 2008 (PubMed).

Hosts (67), (28), (7)
Reactivities (94), (54), (48), (8), (7), (2), (2), (1), (1)
Applications (93), (57), (28), (23), (10), (8), (7), (4), (3), (3), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (11), (11), (10), (7), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
back to top