Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501980

Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ABBP1, HNRPAB, 3010025C11Rik, CBF-A, Cgbfa, Hnrpab, A1F-C1, hm:zeh1271, hnrpab, wu:fa18g02, wu:fb07b06, wu:fb16c05, zeh1271, fd36h02, wu:fd36h02
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501980
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HNRPAB antibody: synthetic peptide directed towards the N terminal of human HNRPAB
Sequence GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFV GGLSWDTSKK
Predicted Reactivity Mouse :100%,   Human :100%,   Pig :92%,   Maize :92%,   Rat :92%,   Cat :92%,   Bovine :85%,   Dog :85%,  
Characteristics This is a rabbit polyclonal antibody against HNRPAB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HNRPAB
Background This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pr
Molecular Weight 36kDa
Gene ID 3182
NCBI Accession NP_112556, NM_031266
UniProt Q99729
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HNRPAB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Heterogeneous Nuclear Ribonucleoprotein A/B (HNRNPAB)", type "Antibodies"
Hosts (14)
Reactivities (10), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (13), (6), (4), (3), (1)
Epitopes (4), (4), (2), (1)
Beacon