Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501989

High Density Lipoprotein Binding Protein (HDLBP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HBP, PRO2900, VGL, AA960365, AI118566, D1Ertd101e, 1110005P14Rik, vigilin, HDLBP
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501989
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HDLBP antibody: synthetic peptide directed towards the middle region of human HDLBP
Sequence RLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAIL RIVGELEQMV
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Pig : 85%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against HDLBP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HDLBP
Background HDLBP is high density lipoprotein-binding protein, also known as vigilin, is a 110-kD protein that specifically binds HDL molecules and may function in the removal of excess cellular cholesterol.High density lipoprotein-binding protein, also known as vigi
Molecular Weight 141kDa
Gene ID 3069
NCBI Accession NP_005327, NM_005336
UniProt Q00341
Research Area Cardiovascular, Atherosclerosis, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HDLBP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "High Density Lipoprotein Binding Protein (HDLBP)", type "Antibodies"
Hosts (43), (4)
Reactivities (43), (18), (17), (3), (2), (2), (1), (1), (1), (1)
Applications (37), (9), (6), (5), (3), (2), (2), (2)
Conjugates (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (7), (2), (2), (2), (2), (1), (1), (1)
Beacon