Did you know that you can buy products from over 140 different suppliers from us?

2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2) (N-Term) antibody

Details for Product No. ABIN502028
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Oasl11, Oasl1, OASL, OAS*A, OAS*B, OASL2
Epitope
N-Term
(6), (3), (2), (1), (1), (1)
Reactivity
Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Human
(26), (13), (13), (12), (1)
Host
Rabbit
(26), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (12), (10), (8), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502028
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human OAS2
Sequence DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSD GTLVLFFSDL
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Bovine : 90 %, Rabbit : 90 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against OAS2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name OAS2
Background OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Weight 79 kDa
Gene ID 4939
NCBI Accession NM_002535, NP_002526
UniProt P29728-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 687 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2) (N-Term) antibody WB Suggested Anti-OAS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: SH-SYSY cell lysate
Background publications Scherer, Muzny, Buhay et al.: "The finished DNA sequence of human chromosome 12...." in: Nature, Vol. 440, Issue 7082, pp. 346-51, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502028
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top