Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502029

2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Oasl11, Oasl1, OASL, OAS*A, OAS*B, OASL2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Pig (Porcine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502029
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OAS2 antibody: synthetic peptide directed towards the middle region of human OAS2
Sequence AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHE QLKAFWREKE
Predicted Reactivity Human : 100%, Pig : 100%, Bovine : 92%, Dog : 92%, Rabbit : 84%
Characteristics This is a rabbit polyclonal antibody against OAS2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OAS2
Background OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Weight 82kDa
Gene ID 4939
NCBI Accession NP_058197, NM_016817
UniProt P29728
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OAS2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Muzny, Buhay et al.: "The finished DNA sequence of human chromosome 12." in: Nature, Vol. 440, Issue 7082, pp. 346-51, 2006 (PubMed).

Alternatives for antigen "2'-5'-Oligoadenylate Synthetase 2, 69/71kDa (OAS2)", type "Antibodies"
Hosts (20)
Reactivities (18), (13), (13), (12), (1), (1)
Applications (10), (9), (6), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1)
Beacon