Did you know that you can buy products from over 140 different suppliers from us?

RNA Binding Motif Protein 47 (RBM47) (Middle Region) antibody

Details for Product No. ABIN502042
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9530077J19Rik, RGD1359713, NET18
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(2)
Host
Rabbit
(2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN502042
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RBM47
Sequence HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSR YQKAARGGGA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against RBM47. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RBM47
Background The function of this protein remains unknown.
Molecular Weight 57 kDa
Gene ID 54502
NCBI Accession NM_019027, NP_061900
UniProt A0AV96-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 524 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RNA Binding Motif Protein 47 (RBM47) (Middle Region) antibody WB Suggested Anti-RBM47 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: NCI-H226 cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502042
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top